Anti-SARS-CoV-2 NSP3 Antibody

rep antibody

Boster Bio Anti-SARS-CoV-2 NSP3 Antibody catalog # A33999. Tested in ELISA applications. This antibody reacts with Human.

Product Info Summary

SKU: A33999
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: ELISA

Customers Who Bought This Also Bought

Product Name

Anti-SARS-CoV-2 NSP3 Antibody

View all rep Antibodies

SKU/Catalog Number

A33999

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-SARS-CoV-2 NSP3 Antibody catalog # A33999. Tested in ELISA applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SARS-CoV-2 NSP3 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A33999)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

HSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALK

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Reactive Species

A33999 is reactive to rep in Human

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

140 kDa, 130 kDa, 110 kDa

Calculated molecular weight

16693 MW

Background of rep

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2'-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A33999 is guaranteed for ELISA Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

ELISA, 0.001-0.1μg/ml, Human

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For rep (Source: Uniprot.org, NCBI)

Gene Name

rep

Full Name

Weight

16693 MW

Alternative Names

Replicase polyprotein 1ab; pp1ab; ORF1ab polyprotein; nsp3; Non-structural protein 3; PL2-PRO; Papain-like proteinase; PL-PRO

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on rep, check out the rep Infographic

rep infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for rep: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A33999

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-SARS-CoV-2 NSP3 Antibody?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-SARS-CoV-2 NSP3 Antibody

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-SARS-CoV-2 NSP3 Antibody

Order DetailsPrice
A33999

100μg

$415
A33999-10ug

10μg sample (liquid)

$99
A33999-Biotin

100 μg Biotin conjugated

$615
A33999-Cy3

100 μg Cy3 conjugated

$615
A33999-Dylight488

100 μg Dylight488 conjugated

$615
A33999-Dylight550

100 μg Dylight550 conjugated

$615
A33999-Dylight594

100 μg Dylight594 conjugated

$615
A33999-FITC

100 μg FITC conjugated

$615
A33999-HRP

100 μg HRP conjugated

$615
A33999-APC

100 μg APC conjugated

$715
A33999-PE

100 μg PE conjugated

$715
A33999-iFluor647

100 μg iFluor647 conjugated

$715
A33999-carrier-free

Carrier Free

$415

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A33999
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$415.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.